DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:282 Identity:90/282 - (31%)
Similarity:126/282 - (44%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 GKP---LTVHILDGERVDRGVYPHMAAI--AYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDST 437
            |:|   |...|:.|.....|.:|.|.::  .|..|      ||||||.:::|||||||:  .|.|
Zfish    26 GRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHF------CGGSLINNQWVLTAAHCI--VDQT 82

  Fly   438 PS--FVRLGALNIENPEPGY-QDINVIDVQI-----HPDYSGSSKYYDIAILQLAEDAKESDVIR 494
            ||  .|.||...      .| .|:|.|...|     ||.||..:|..|||:|||....:.:|.|:
Zfish    83 PSSIIVYLGKWR------SYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIK 141

  Fly   495 PACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSK-------------ILLRAALDLVPADECNAS 546
            |.||..:.|:.|.....:|||||.:.|......:             ||..|.|.:....:||  
Zfish   142 PICLADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCN-- 204

  Fly   547 FAEQPSANRTLRRG-VIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA 610
                     .:..| :..:.:||..:...|....|||||||:.:.    ..:...||:|.|:|||
Zfish   205 ---------NICHGRITPNMICAGTRPGGKATFSGDSGGPLMTKC----SVWVQAGVLSHGYGCA 256

  Fly   611 -TKTPGLYTRVSSFLDYIEGIV 631
             ...|.::.|||.:..:|.|.|
Zfish   257 QPNLPEVFIRVSEYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 84/267 (31%)
Tryp_SPc 385..630 CDD:238113 85/269 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.