DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and prss8

DIOPT Version :10

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:130 Identity:29/130 - (22%)
Similarity:51/130 - (39%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LLSWLGVPSIVQLIFGVIIAISAVCSYVY----LFESRSSSLLQNRFRISRKSTRIIYHRIIFFY 158
            |::|.||.|.||..|  ..:|..:...:|    |.:|....:|....::|:          |..:
 Frog     9 LMAWFGVLSCVQAEF--FTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSK----------IKSW 61

  Fly   159 NCAILLVFFKTPSDQEAAKLEALTIYPCPTREFFEFPVL--IVLSDQKTAQFVTYIFIPSMFLQT 221
            ...:..:..|:.:|.|......:..|....|...::|.|  :||.| ..|.|:..:.:...|..|
 Frog    62 ANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQD-SAAGFIANLSVQRQFFPT 125

  Fly   222  221
             Frog   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 385..630 CDD:238113
prss8NP_001016980.1 Tryp_SPc 30..269 CDD:238113 20/107 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.