DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:121/265 - (45%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 KIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDST 437
            :||.||  :...|.:|.....|..|::..::.||.|: .:.||||:|...:|||||||....|..
  Fly    31 EIRHGG--IEGRITNGNLASEGQVPYIVGVSLNSNGN-WWWCGGSIIGHTWVLTAAHCTAGADEA 92

  Fly   438 PSFVRLGALNIENPEPGYQDI----NVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIR---P 495
            ..:  .||:|..  ||.::..    |.|.   :|.|.|..  :|:|:::.......|.|.:   |
  Fly    93 SLY--YGAVNYN--EPAFRHTVSSENFIR---YPHYVGLD--HDLALIKTPHVDFYSLVNKIELP 148

  Fly   496 ACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRG 560
            :  ..||.:...|.....||||.:...:..|..:.: ..|.::...||.|.:....::..|:   
  Fly   149 S--LDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRV-VDLKVISVAECQAYYGTDTASENTI--- 207

  Fly   561 VIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVIS--SGFGCATKTPGLYTRVSSF 623
                   ..:....|..|||||||||:.:..|     .::|:.|  |.:||....|..:|||:.:
  Fly   208 -------CVETPDGKATCQGDSGGPLVTKEGD-----KLIGITSFVSAYGCQVGGPAGFTRVTKY 260

  Fly   624 LDYIE 628
            |::|:
  Fly   261 LEWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/251 (27%)
Tryp_SPc 385..630 CDD:238113 70/253 (28%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 69/251 (27%)
Tryp_SPc 41..266 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437022
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.