DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG11842

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:244 Identity:81/244 - (33%)
Similarity:121/244 - (49%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 YPHMAAIAY-NSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIE--NPEPGYQD 457
            :||.|.:.: :..|...:.|||:||:.|.|||||||..|...:.:..|||.|..:  |.:...:|
  Fly    84 FPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPED 148

  Fly   458 INVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVT 522
            .:|.|...||::|..:.|.||::::|:.....:|...||||..|  |......:...|||.:.:.
  Fly   149 FDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD--DGRLGTSFIAIGWGQLEIV 211

  Fly   523 NRAVSKILLRAAL------DLVPADECNASFAEQPSANRTLRRGVIA-SQLCAADKNQRKDACQG 580
            .|..:|.|.:..|      ..:.||.           |..|..|..| :|||.. .|:.||.|.|
  Fly   212 PRTENKKLQKVKLYNYGTRCRITADR-----------NDELPEGYNATTQLCIG-SNEHKDTCNG 264

  Fly   581 DSGGPLILEIDDVDGTYSIVGVISSGFGCAT-KTPGLYTRVSSFLDYIE 628
            |||||:::...|....|.::|:.|.|..|.| ..|.:||||..:||:|:
  Fly   265 DSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 80/241 (33%)
Tryp_SPc 385..630 CDD:238113 81/244 (33%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 81/244 (33%)
Tryp_SPc 73..312 CDD:214473 80/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.