DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG11841

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:271 Identity:93/271 - (34%)
Similarity:139/271 - (51%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 SVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGS-AAFRCGGSLIASRFVLTAAHC 430
            :|.:|.    |.:||   |:||...:...:|..|.:.:....: ..:.|||:||::|.|||||||
  Fly    61 TVDSCH----GSRPL---IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHC 118

  Fly   431 VNSDDSTPSFVRLGAL----NIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESD 491
            ..|:....:.||||.|    :.::.||  :|..|:.::.||.:.....|.||.|:||..:.|.:.
  Fly   119 FFSEHGEVNVVRLGELEFDTDTDDAEP--EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNR 181

  Fly   492 VIRPACLYTDRSDPPANYKYFVA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANR 555
            ...||||..|..:   .::.|:| |||......:. ||.||:..|... .|.|.:|.    .||.
  Fly   182 YKHPACLPFDDGE---QHESFIAIGWGQKKFAQKE-SKKLLKVQLQGY-KDRCVSSV----DAND 237

  Fly   556 TLRRGV-IASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCAT-KTPGLYT 618
            .|..|. ..||||...:: .||.|.||||||::....|:...|.::|:.|:|..|:| ..|..||
  Fly   238 ELPNGYEPKSQLCIGSRD-NKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYT 301

  Fly   619 RVSSFLDYIEG 629
            ||..||::|:|
  Fly   302 RVHYFLNWIKG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 86/250 (34%)
Tryp_SPc 385..630 CDD:238113 88/253 (35%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 86/250 (34%)
Tryp_SPc 72..310 CDD:214473 86/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.