DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG4815

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:95/237 - (40%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 MAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPG--YQDINVI 461
            :..:....|......|..:|:..|.:||||||..:.:.: .|..:|..:.|....|  :....:|
  Fly    46 LGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRS-KFHVIGGKSAEFTWHGNNFNKNKLI 109

  Fly   462 DVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL-YTD--RSDPPANYKYFVAGWGVM-NVT 522
            .|||||.|:......|:|:      ||....:|...: |..  ||......|...||||.. .|.
  Fly   110 RVQIHPKYAKMKFIADVAV------AKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVW 168

  Fly   523 NRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLI 587
            :.:..|......:.:|...:|          .:.|.|.:..:.:||...| .|..|.|||||||:
  Fly   169 DESRKKTFRSMKVGIVSKRDC----------EKQLDRKMPPNIICAGAYN-NKTLCFGDSGGPLL 222

  Fly   588 LEIDDVDGTYSIVGVISSGFGCA-TKTPGLYTRVSSFLDYIE 628
            |       ...:.|:.:..|.|. .:.|.:|..|..:..:|:
  Fly   223 L-------GRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 59/234 (25%)
Tryp_SPc 385..630 CDD:238113 60/237 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 60/234 (26%)
Trypsin 49..256 CDD:278516 59/231 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.