DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG16710

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:294 Identity:95/294 - (32%)
Similarity:135/294 - (45%) Gaps:48/294 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAF------RCGGSLIASRFV 424
            |:...|..|..     ...|..||.......|.||.|.|.....:.:      ||.||||.:|:|
  Fly    92 PNTQICGPIMP-----AYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYV 151

  Fly   425 LTAAHCVNSDDSTPSFVRLGALNI-ENPE------------PGYQDINVIDVQI-HPDYS--GSS 473
            ||||||:.........||||..|| .||:            |.:.:|:| |:.| |..|.  ...
  Fly   152 LTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDV-DLSIKHRHYMVFEER 215

  Fly   474 KYYDIAILQLAEDAKESDVIRPACLYTDR--SDPP-ANYKYFVAGWGVMNVTNRAVSKILLRAAL 535
            .|.|||:|:|....:.:..|:|.|:..|.  |:|. :|:|..:||||:.:  .:..|.:||:|.:
  Fly   216 PYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSH--KQGYSNVLLQAYV 278

  Fly   536 DLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPL--ILEIDDVDGTYS 598
            :...||||:.|   :||........:.|..|..      .|.|:|||||||  |:|..|.:..| 
  Fly   279 NGRNADECSLS---EPSLGLDKETHICAGNLGG------NDTCKGDSGGPLMAIMERGDEEFVY- 333

  Fly   599 IVGVISSGFGCATKTPGLYTRVSSFLDYIEGIVW 632
            :.|:.|.|:......|..||:.|.|   :|.|:|
  Fly   334 LAGITSYGYSQCGYGPAAYTKTSKF---VEWILW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 89/269 (33%)
Tryp_SPc 385..630 CDD:238113 90/271 (33%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 90/272 (33%)
Tryp_SPc 106..362 CDD:238113 90/271 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.