DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG8870

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:261 Identity:79/261 - (30%)
Similarity:119/261 - (45%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 YPHMAAIAYNSFGSAAF----RCGGSLIASRFVLTAAHCVNSDDSTPSF----VRLGALNIE-NP 451
            :|.||.:.|.:..:.:.    :||||||.:.:||||||||........:    ||||..|.. ||
  Fly    95 FPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNP 159

  Fly   452 E-----------PGYQDINVIDVQIHPDYS-GSSKYYDIAILQLAEDAKESDVIRPACLYTDRSD 504
            :           |.|.:|.|..:..|..:: |.....|||:::|....:.:..|:|.||...:..
  Fly   160 DRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKL 224

  Fly   505 PPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAA 569
            .....|:..:||..|.  ....|::|||:.:.....|.|.:::...           :.||:||.
  Fly   225 AAHKRKFQASGWPDMG--QGIASEVLLRSFIAERHPDVCKSNYDFN-----------LGSQICAG 276

  Fly   570 --DKNQRKDACQGDSGGPLILEI--DDVDGTYSIVGVISSG-FGCATKT--PGLYTRVSSFLDYI 627
              |.|   |...|||||||:..:  ..|..||: .|:||.| ..|..||  |..||:.|.|.::|
  Fly   277 GLDGN---DTSPGDSGGPLMETVIRGKVTLTYA-AGIISYGQKPCVLKTCKPAFYTKTSYFFEWI 337

  Fly   628 E 628
            :
  Fly   338 K 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 78/258 (30%)
Tryp_SPc 385..630 CDD:238113 79/261 (30%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 79/261 (30%)
Tryp_SPc 93..337 CDD:214473 78/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.