DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG11670

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:431 Identity:125/431 - (29%)
Similarity:184/431 - (42%) Gaps:115/431 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 EPAREVPMVLQTTPTPTPAPTPTQL-IDPFEPYRFRGQDRDKDTQPQEPWNDVSNNLDADPAPSI 340
            ||.|        .|.|.|.|.||:. .:.:..|.:.||           |           ||..
  Fly    35 EPYR--------NPNPNPVPDPTRWDFNNYNSYGYNGQ-----------W-----------APGY 69

  Fly   341 FNP-AETRPTTPNPNPSRVNLPEKERP-------SVAACEKIRSGGKPL---------------- 381
            ||. ...||..|.|:|.....|....|       ....|.  ...|.||                
  Fly    70 FNNYGYYRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCP--GGPGGPLQHRQWDNGPRQWQPRR 132

  Fly   382 ---------------TVHILDGERVDR-------------------GVYPHMAAIAY-NSFGSAA 411
                           |...:|||..::                   |.||||||:.: |......
  Fly   133 PPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDDFNGRSIVAPGQYPHMAALGFRNENHEID 197

  Fly   412 FRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIE----NPEPGYQDINVIDVQIHPDYSGS 472
            ::||||||:..||||||||:.:..::|..|::|.:.::    |..|  |...|..:.:||.|:.|
  Fly   198 YKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAP--QRRRVAQIYLHPLYNAS 260

  Fly   473 SKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDL 537
            ..|:||.::||....:.:..:||..|: ..:|.|.. |....|:|..... :..:.||....|.:
  Fly   261 LNYHDIGLIQLNRPVEYTWFVRPVRLW-PMNDIPYG-KLHTMGYGSTGFA-QPQTNILTELDLSV 322

  Fly   538 VPADECNASF-AEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEID--------DV 593
            ||.::||:|. |::.|.:     |::.||:||.|..:.:|.|||||||||.|.::        ..
  Fly   323 VPIEQCNSSLPADEGSPH-----GLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRK 382

  Fly   594 DGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIEGIVWPS 634
            ...|.:||:.|.|..|.::.||:||||||::|:|..||||:
  Fly   383 HYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASIVWPN 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 91/275 (33%)
Tryp_SPc 385..630 CDD:238113 92/277 (33%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 89/256 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.