DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG13318

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:472 Identity:112/472 - (23%)
Similarity:174/472 - (36%) Gaps:137/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VGAWGIAPSKTQPIASTQRSFMEPEWGREPRIVNRPLTTPRSRPQRPNNSNFNTNPSPNNNNLIH 263
            ||||...|.::.....|.|.                       ||          ||...:...|
  Fly    24 VGAWSFGPVQSDASQDTNRV-----------------------PQ----------PSDVGSTANH 55

  Fly   264 LVNDRLREQGMQIEPAREVPMVLQTTPTPTPAPTPTQLIDPFEPYRFRGQDRDKDTQPQEPWNDV 328
            .:..|....|..:.|        |..|...| |.|: ::.|...|                    
  Fly    56 TILARQLIVGTLLPP--------QVAPGTWP-PVPS-IVSPGTSY-------------------- 90

  Fly   329 SNNLDADPAPSIFNPAETRPTTPNPNPSRVNL--------PEKERPS---------VAACE--KI 374
               ....|..|..||.   ||.|:....::::        |.....|         ||.|:  ..
  Fly    91 ---CQCVPPGSCANPL---PTAPSDGSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQAGSY 149

  Fly   375 RSGGK----PLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDD 435
            :.|.:    |.:.....|: ...|.||..||:...   :..:..||:||.::.||||||.|.:..
  Fly   150 QCGRRFPPPPGSTTAAPGQ-ASFGAYPWQAALLTT---ADVYLGGGALITAQHVLTAAHKVYNLG 210

  Fly   436 STPSFVRLG---ALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAK--ESDVIRP 495
            .|...||||   |.:...|.|. ||:.:.:|.::|.::.::...|:|||:|:....  ....:..
  Fly   211 LTYFKVRLGEWDAASTSEPIPA-QDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGT 274

  Fly   496 ACLYTDRSDPPANY---KYFVAGWGVMNV-TNRAVSKILLRAALDLVPADECNA---------SF 547
            .||      |..::   :.:|||||..:. ...|...|..:..:.|:|...|.|         ||
  Fly   275 VCL------PTTSFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSF 333

  Fly   548 AEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA-T 611
            ...|:           |.:||..: ..||||.||.|.||:.   ..:|.:.:||:::.|.||| .
  Fly   334 VLSPT-----------SFICAGGE-AGKDACTGDGGSPLVC---TSNGVWYVVGLVAWGIGCAQA 383

  Fly   612 KTPGLYTRVSSFLDYIE 628
            ..||:|..|.::|.:|:
  Fly   384 GVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 75/261 (29%)
Tryp_SPc 385..630 CDD:238113 76/263 (29%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 75/257 (29%)
Tryp_SPc 169..399 CDD:214473 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.