DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and MP1

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:351 Identity:119/351 - (33%)
Similarity:163/351 - (46%) Gaps:81/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RDKDTQPQEPWNDVSNNLDADPAPSIFNPAETRPTTPNPNPSRVNLPEKERPSVAACEKIRSGGK 379
            |.::.|||  |.:                        :|.|::...|.|           |||.|
  Fly    95 RMRNQQPQ--WGN------------------------HPQPTQTTKPTK-----------RSGTK 122

  Fly   380 PLTV----------HILDGERVDRGVYPHMAAIAYNSFGSA-AFRCGGSLIASRFVLTAAHCVNS 433
            .|.:          .::.|....:..:|.||.|.|...|:. ...||||||..|:||||||||::
  Fly   123 LLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSA 187

  Fly   434 --DDSTPSFVRLGALNIE-NPE-----PGYQDIN--VIDVQI-----HPDYSGSSK--YYDIAIL 481
              .|...:.||||..:.. ||:     .|.:|.|  .:|..:     ||.|.|:|:  ..|||:|
  Fly   188 IPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALL 252

  Fly   482 QLAEDAKESDVIRPACLYTDRSDPPANY---KYFVAGWGVMNVTNRAVSKILLRAALDLVPADEC 543
            :|.::.:.||.|.|.||.|..|.....:   |..|||||  .......|.|.|:|.||.||..||
  Fly   253 RLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWG--RTETNFTSNIKLKAELDTVPTSEC 315

  Fly   544 NASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILE-IDDVDGTYSIVGVISSG- 606
            |..:|.|       ||.|...|:||... :..|:|:|||||||:|| ..:.:..|.|.||:|.| 
  Fly   316 NQRYATQ-------RRTVTTKQMCAGGV-EGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGP 372

  Fly   607 FGCATK-TPGLYTRVSSFLDYIEGIV 631
            ..|..| .||:||||.::|::||..|
  Fly   373 TPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 102/266 (38%)
Tryp_SPc 385..630 CDD:238113 104/268 (39%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 102/266 (38%)
Tryp_SPc 138..397 CDD:238113 104/268 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.