DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG14088

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:262 Identity:61/262 - (23%)
Similarity:102/262 - (38%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GERVDRGVYPHM----AAIAYNSFGSAAFRCG-GSLIASRFVLTAAHCVNSDDSTPSFVRLGALN 447
            |||.| |:.|.:    .||.:: ||...   | |:||..||:||..||.:|         :|.:.
  Fly    32 GERRD-GLSPDIVGPWTAILHH-FGRIV---GVGTLIHERFILTDVHCGDS---------IGVIR 82

  Fly   448 IENPEPG------YQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD-RSDP 505
            ....|.|      .:|..|.....:.:::..::..::.:::|.......:.|.|.|:..| |...
  Fly    83 ARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQT 147

  Fly   506 PANYKYFVAG--WGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCA 568
            .|:...:..|  |...:.:....||.::|                 .|.|...|..|    |.||
  Fly   148 FADELDYFNGTTWKNSDKSPMLRSKTVIR-----------------MPQACGKLDHG----QFCA 191

  Fly   569 ADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIEGIVWP 633
            ..|:  .|:|...||..|..|||.:....:::..|::...........||.|.....:|..:::.
  Fly   192 GHKD--LDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQWISMVIYS 254

  Fly   634 SN 635
            ||
  Fly   255 SN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 58/252 (23%)
Tryp_SPc 385..630 CDD:238113 59/255 (23%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 53/244 (22%)
Tryp_SPc 42..248 CDD:214473 52/241 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.