DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG7542

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:134/273 - (49%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 VAACEKIRSGGKPLTV----HILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAA 428
            |.:|..:     ||..    :|.:||..:.|.:|:.|.:.. |||:.:..|||:||:..:::|||
  Fly    11 VGSCTAV-----PLLTDVEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWCGGTLISHYWIITAA 69

  Fly   429 HCVNSDDSTPSFVRLGALNI-ENPEPGYQDINV--IDVQIHPDYSGSSKYYDIAILQLAEDAKES 490
            ||::..:|..  |.|||:|| :..|.|.:.|.|  ..:.:|.:|..|:...||::::|......:
  Fly    70 HCMDGAESVT--VYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFT 132

  Fly   491 DVIRPACLYTDRSDPPANY---KYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552
            |.||.|.|....:.....|   :.|.:|||..:..:.:||.:|....:.::|...|         
  Fly   133 DRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC--------- 188

  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYS-IVGVISSG--FGCATKTP 614
              |....|.::.::........|..|.|||||||:.:    .|..| ::|..|.|  .||....|
  Fly   189 --RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYK----QGNSSYLIGSTSFGTSMGCQVGFP 247

  Fly   615 GLYTRVSSFLDYI 627
            .::||:||:||:|
  Fly   248 AVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 76/251 (30%)
Tryp_SPc 385..630 CDD:238113 77/252 (31%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/252 (31%)
Tryp_SPc 27..260 CDD:214473 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437046
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.