DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG18180

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:109/266 - (40%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCG-GSLIASRFVLTAAHCVNSDDSTPSFVRL----- 443
            |::|.....|..|::..:...:.||.:...| |::||:.::||||||:..|     :|.:     
  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGD-----YVEIHYGSN 95

  Fly   444 ----GA----LNIEN-------PEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVI 493
                ||    :..:|       |..|.:||.:|... |.|::|......:..:....| :..|..
  Fly    96 WGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRTP-HVDFNGLINKIPLPSMNEQND-RYQDTW 158

  Fly   494 RPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLR 558
            ..||                 |||.|:  |..::..|....:.::...||..::.          
  Fly   159 CVAC-----------------GWGGMD--NGNLADWLQCVDVQIISNSECEQAYG---------- 194

  Fly   559 RGVIASQLCA--ADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVS 621
             .|.::.:|.  ||   .|..|.|||||||:.. |:.    .:||||:.........|..|||||
  Fly   195 -SVASTDMCTRHAD---GKSVCGGDSGGPLVTH-DNA----RLVGVITFASVSCHDGPSGYTRVS 250

  Fly   622 SFLDYI 627
            .:|::|
  Fly   251 DYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 66/264 (25%)
Tryp_SPc 385..630 CDD:238113 67/266 (25%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/264 (25%)
Tryp_SPc 36..259 CDD:238113 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.