DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG18179

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:110/255 - (43%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCG-GSLIASRFVLTAAHCVNSDDSTPSFVRL----- 443
            |::|.....|..|::..:...:.||.:...| |::|||.::||||||:.:|     :|.:     
  Fly    40 IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD-----YVEIHYGSN 99

  Fly   444 ----GALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL--YTDR 502
                ||..        |.:...:...||::..... .||.::: ......:|:|....|  :::.
  Fly   100 WGWNGAFR--------QSVRRDNFISHPNWPAEGG-RDIGLIR-TPSVGFTDLINKVALPSFSEE 154

  Fly   503 SDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567
            ||...:......|||.|:  |..::..|....:.::...||..|:            |.:||...
  Fly   155 SDRFVDTWCVACGWGGMD--NGNLADWLQCMDVQIISNSECEQSY------------GTVASTDM 205

  Fly   568 AADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYI 627
            ...:...|.:|.|||||||:.. |:.    .:||||:.|.......|..||||:.:|.:|
  Fly   206 CTRRTDGKSSCGGDSGGPLVTH-DNA----RLVGVITFGSVDCHSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 64/253 (25%)
Tryp_SPc 385..630 CDD:238113 65/255 (25%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 64/253 (25%)
Tryp_SPc 40..263 CDD:238113 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436990
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.