DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG8329

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:117/262 - (44%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFV 441
            ||.|..: |::|.....|..|:...:..|: |:..   |||:|.:.:|||||||:.:|..|   :
  Fly    28 GGGPKDI-IVNGYPAYEGKAPYAVGLRMNN-GAVG---GGSVIGNNWVLTAAHCLTTDSVT---I 84

  Fly   442 RLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL--YTDRSD 504
            ..|:....|.:..: .:|..:...||.|..|:. :||.::: ......:::|....|  ::.:.:
  Fly    85 HYGSNRAWNGQLQH-TVNKNNFFRHPGYPNSAG-HDIGLIR-TPYVSFTNLINKVSLPKFSQKGE 146

  Fly   505 PPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAA 569
            ...|:.....|||.|  .|..::..|....:.::...||..|:            |.:||.....
  Fly   147 RFENWWCVACGWGGM--ANGGLADWLQCMDVQVISNGECARSY------------GSVASTDMCT 197

  Fly   570 DKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVIS-SGFGCATKTPGLYTRVSSFLDYI---EGI 630
            .....|..|.|||||.|:...:.:.     ||||: :..||.:...| |||||..||:|   .||
  Fly   198 RATDGKSVCGGDSGGALVTHDNPIQ-----VGVITFASIGCKSGPSG-YTRVSDHLDWIREKSGI 256

  Fly   631 VW 632
            .:
  Fly   257 AY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 65/245 (27%)
Tryp_SPc 385..630 CDD:238113 66/250 (26%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 66/247 (27%)
Tryp_SPc 35..250 CDD:214473 65/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.