DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Jon66Cii

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:267 Identity:67/267 - (25%)
Similarity:104/267 - (38%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 KPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRL 443
            |.:...|.:|...:.|..|:...:.:    |..:.||||:||..:||||.||:...||..  |..
  Fly    34 KDMQGRITNGYPAEEGKAPYTVGLGF----SGGWWCGGSIIAHDWVLTAEHCIGDADSVT--VYF 92

  Fly   444 GALNIENPEPGYQDINVIDVQIHPDYSGSSKYY-----DIAILQLAED---AKESDVIRPACLYT 500
            ||....|.:             ...:.|:..:.     |||::::...   ...:.|..|:  |.
  Fly    93 GATWRTNAQ-------------FTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPS--YN 142

  Fly   501 DRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQ 565
            ||.:....:.....||| .......:...|....|.::...||:..:            |.:...
  Fly   143 DRYNDYNEWWAVACGWG-GTYDGSPLPDYLQCVDLQIIHNSECSGYY------------GSVGDN 194

  Fly   566 LCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLDYIE 628
            :........|..|.|||||||:..    ||| .:|||.:.|  .||.:..|..:.||:..||:|.
  Fly   195 ILCVRTPDGKSTCGGDSGGPLVTH----DGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254

  Fly   629 ---GIVW 632
               ||.:
  Fly   255 DHTGIAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 63/252 (25%)
Tryp_SPc 385..630 CDD:238113 64/257 (25%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/252 (25%)
Tryp_SPc 40..256 CDD:238113 64/254 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436974
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.