DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and sphinx2

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:277 Identity:57/277 - (20%)
Similarity:106/277 - (38%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 AACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCG-GSLIASRFVLTA----- 427
            :.|||     ..|:..|..|.|.......::..|.|.....::.:.| |::|:::::||.     
  Fly    15 SVCEK-----NKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLI 74

  Fly   428 -----AHCVNSDDSTPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAE-- 485
                 ||.    .|..:|.            ||..:.:.....:..|   .|...||:::...  
  Fly    75 FKYIEAHF----GSKRAFW------------GYDILRIYRENFYFHY---DKTRIIALVKCPYQK 120

  Fly   486 -DAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAE 549
             |.:.|.|..||  |..|.:........|.|||    |::  .|:.|...:..|..:..|.:  |
  Fly   121 FDRRMSRVRVPA--YGARFERYVGNMTMVCGWG----TDK--RKVRLPTWMRCVEVEVMNNT--E 175

  Fly   550 QPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVI-SSGFGCATKT 613
            ....:..|:    ..::|.:.:. .|..|:||.||.::    .:....:.:|:| .....|:...
  Fly   176 CAKYHTPLK----WYEMCTSGEG-FKGVCEGDMGGAVV----TMGPNPTFIGIIWLMPTNCSIGY 231

  Fly   614 PGLYTRVSSFLDYIEGI 630
            |.::.|||..:.:|:.:
  Fly   232 PSVHIRVSDHIKWIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 52/257 (20%)
Tryp_SPc 385..630 CDD:238113 53/259 (20%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 52/257 (20%)
Tryp_SPc 26..248 CDD:304450 53/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.