DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG10472

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:322 Identity:89/322 - (27%)
Similarity:144/322 - (44%) Gaps:72/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 WNDVSN-NLDADPAPSIFNPAETRPTTPNPNPSRVNLPEKERPSVAACEKIRSGGKPLTVHILDG 388
            ||.|.| |::                ||.|......||              ||      .|..|
  Fly    22 WNSVKNLNIE----------------TPMPKVHGETLP--------------SG------RITGG 50

  Fly   389 ERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIEN-PE 452
            :..:...:|:...:.....|.||: |||::|:.|:::|||||.:| .:|...|.|||.:..| .|
  Fly    51 QIAEPNQFPYQVGLLLYITGGAAW-CGGTIISDRWIITAAHCTDS-LTTGVDVYLGAHDRTNAKE 113

  Fly   453 PGYQDI-----NVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANY--- 509
            .|.|.|     |||   :|.|:...:...||::::|....:.:..|:||.|.. :||..:.|   
  Fly   114 EGQQIIFVETKNVI---VHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPV-KSDSYSTYGGE 174

  Fly   510 KYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQR 574
            ....:|||.::.:....:.||..|.:.::....|:..:.           |::|:..........
  Fly   175 NAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYF-----------GLVAASNICIKTTGG 228

  Fly   575 KDACQGDSGGPLILEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLDYIE---GIV 631
            ...|.|||||||:|:    ||:.:::|..|.|  .||....||::||::.:||:||   |:|
  Fly   229 ISTCNGDSGGPLVLD----DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGVV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 73/253 (29%)
Tryp_SPc 385..630 CDD:238113 75/258 (29%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 73/253 (29%)
Tryp_SPc 47..282 CDD:238113 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437042
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.