DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:120/277 - (43%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 LPEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFV 424
            :|.|:.|:          |..:...|.:|.....|..|::.|:.:::.....:.||||:|...:|
  Fly    22 VPVKDMPA----------GNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWV 76

  Fly   425 LTAAHCVNSDDSTPSFVRL--GALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAED- 486
            ||||||...    .|:|.:  ||:..:.|:             ...|...:.:.|||:::.... 
  Fly    77 LTAAHCTYG----ASYVTISYGAVWRQQPQ-------------FTHYDTGNLHNDIALIRTPHVD 124

  Fly   487 --AKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADE--CNASF 547
              :..:.|..|.  |.||.:....:...::|||..:.::.....:   ..:|:..:|.  |...:
  Fly   125 FWSLVNKVELPR--YDDRYNNFYGWWALLSGWGSSSDSSGMTDYL---NCVDIQISDNSVCLDYY 184

  Fly   548 AEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVIS--SGFGCA 610
            ..         ..:.::.||.|.. :.|.:|.|||||||:|.    ||... ||::|  |..||.
  Fly   185 GS---------HYITSNHLCYATP-ENKGSCSGDSGGPLVLH----DGNRQ-VGIVSFGSAAGCL 234

  Fly   611 TKTPGLYTRVSSFLDYI 627
            :.:|...|||:.:||:|
  Fly   235 SNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 64/251 (25%)
Tryp_SPc 385..630 CDD:238113 65/252 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/251 (25%)
Tryp_SPc 37..254 CDD:238113 65/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436962
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.