DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and yip7

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:129/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PSVAACE-KIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAH 429
            |::|... :.|.....:|..|.:|:....|.:|:...::::| .:.::.||||:|.:.:||||||
  Fly    20 PNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSS-SAGSWWCGGSIIGNEWVLTAAH 83

  Fly   430 CVNSDDSTPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAE---DAKESD 491
            |  :|.:....:..||....:|| ..|.::....:.|..|...:...||:::|.:.   .|..:.
  Fly    84 C--TDGAASVTIYYGATVRTSPE-FTQVVSSSKFRQHESYLALTIRNDISLIQTSSVSFSATVNK 145

  Fly   492 VIRPACLYTDRSDPPANY--KYFVA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSA 553
            :..||.     |:..:.|  |..|| |||:.:....|||:.|....|.::...:|..:|...   
  Fly   146 ISLPAV-----SNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSL--- 202

  Fly   554 NRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF--GCATKTPGL 616
                   ::.|::...|...:...|||||||||.|     ||.  ::|..|.|.  ||.:..|..
  Fly   203 -------IVTSRVLCVDTTNKASTCQGDSGGPLAL-----DGV--LIGATSFGSADGCESGAPAA 253

  Fly   617 YTRVSSFLDYIE 628
            :||::.:.|:|:
  Fly   254 FTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/250 (28%)
Tryp_SPc 385..630 CDD:238113 70/252 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 69/250 (28%)
Tryp_SPc 40..267 CDD:238113 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437026
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.