DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG30283

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:84/256 - (32%)
Similarity:119/256 - (46%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIE 449
            ||.|........|.||.:    .|...|.|||:||.:|||||:|||:.:.:..   ||||.|   
  Fly    43 ILGGHNAPVASAPWMAMV----MGEGGFHCGGTLITNRFVLTSAHCIANGELK---VRLGVL--- 97

  Fly   450 NPEPGYQDINVIDVQIHPDYSGSSKYY---DIAILQLAEDAKESDVIRPACLYTD---RSDPPAN 508
            ..|...|...|..:.:|.||     |:   |:|:|:||:....||.|.|.||..|   ::.....
  Fly    98 EREAEAQKFAVDAMFVHTDY-----YFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHI 157

  Fly   509 YKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQ 573
            .|:...|||  ...:|:.|::|.:.:|..:...||...:..| ..||        :.:||...| 
  Fly   158 VKFRTYGWG--KTESRSSSRMLQKTSLFNLHRSECAKQYPHQ-QINR--------NHICAESAN- 210

  Fly   574 RKDACQGDSGGPL--ILEIDDVDGTYSIVGVISSGFG-CATKTPGLYTRVSSFLDYIEGIV 631
             .:.|.|||||||  |:..|.|...:.. ||.|.|.. |:..|  ::|.|.:.||:|...|
  Fly   211 -ANTCNGDSGGPLTAIVTYDHVQMVFQF-GVTSFGHADCSKAT--VFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/250 (33%)
Tryp_SPc 385..630 CDD:238113 83/253 (33%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 82/250 (33%)
Tryp_SPc 43..266 CDD:238113 83/253 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.