DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG4927

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:332 Identity:97/332 - (29%)
Similarity:158/332 - (47%) Gaps:52/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DVSNNLDADPAPSIFNPAETRPTTPNPNPSRVNLPEKERPSVAACEK---IRSGGKPLTVHILDG 388
            |.||::.....|:...| :::..:.|....|.   |||      |.:   ||:..: .|..|:.|
  Fly    55 DKSNHIVCCLLPNNMQP-QSQQFSANIGLRRF---EKE------CRRFNEIRTSCR-TTPFIVGG 108

  Fly   389 ERVDRGVYPHMAAIAYNSFGSAA--FRCGGSLIASRFVLTAAHCVNSDDS-----TPSF------ 440
            .:.....:|.||.:......|:.  :.||..:|..:||||||||:.:.::     .|::      
  Fly   109 AKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYV 173

  Fly   441 VRLGALN----IENPEPGYQDINVIDVQIHPDY-----SGSSKYYDIAILQLAEDAKESDVIRPA 496
            ||||.|:    .::.:|  ||..|::..:||.|     :||.| .|||:::|..:|..|:.:.||
  Fly   174 VRLGELDYNSTTDDAQP--QDFRVLNYVVHPAYGEDDDTGSRK-NDIAVVELEMEATFSEYVAPA 235

  Fly   497 CLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGV 561
            ||..|..:  ...:...||||..:.:..| |..||:.:||.....||         :.|...:..
  Fly   236 CLPLDGGN--EQLQVAAAGWGATSESGHA-SSHLLKVSLDRYDVAEC---------SQRLEHKID 288

  Fly   562 IASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATK-TPGLYTRVSSFLD 625
            :.:||||..::...|.|.||||||:.::.........::|:.|.|..|..: .|.:||:|..:.|
  Fly   289 VRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTD 353

  Fly   626 YIEGIVW 632
            :||.|||
  Fly   354 WIENIVW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 78/265 (29%)
Tryp_SPc 385..630 CDD:238113 80/267 (30%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 80/267 (30%)
Tryp_SPc 105..355 CDD:214473 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.