DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG12133

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:293 Identity:87/293 - (29%)
Similarity:138/293 - (47%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFR----CGGSLIASRFVLT 426
            |....|     |..|.:.:|:.|.......:|....:.|.:: :|..|    |.|||||||:|||
  Fly    48 PDSRVC-----GQSPPSSYIVGGMEAQSNQFPWTVLLGYEAY-TAKQRPSPMCAGSLIASRYVLT 106

  Fly   427 AAHCVNSDDSTPSFVRLGALNIEN-PE------------PGYQDINVIDVQI-HPDY--SGSSKY 475
            ||||:|.:|...:.||||..:.|| |:            |.:.||:| |::: |..|  .....|
  Fly   107 AAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDV-DLRVPHEQYYTRNGRHY 170

  Fly   476 YDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYF---VAGWGVMNVTNRAVSKILLRAALDL 537
            .|||:|:|....|.:..|||.|::.......:::|.|   :||||...:..:  |.:|.:..:..
  Fly   171 NDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQK--STVLRQGTISG 233

  Fly   538 VPADECNASFAEQPSANR----TLRRGVIASQLCAADKNQRKDACQGDSGGPLILEID-DVDGTY 597
            :..|||         .||    .:.:.:   |:||...: ..|...||||.||:..:. ..|..|
  Fly   234 MSPDEC---------LNRYPTLLVDKDI---QICAMGWD-GTDTGLGDSGSPLMASVGRGADQFY 285

  Fly   598 SIVGVISSGFGCAT--KTPGLYTRVSSFLDYIE 628
            .:.|:.|.|.|.::  ..|.:||:.||:.::|:
  Fly   286 YLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/272 (30%)
Tryp_SPc 385..630 CDD:238113 83/274 (30%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 83/274 (30%)
Tryp_SPc 62..317 CDD:214473 82/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.