Sequence 1: | NP_001097020.1 | Gene: | Hayan / 32831 | FlyBaseID: | FBgn0030925 | Length: | 637 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 63/260 - (24%) |
---|---|---|---|
Similarity: | 99/260 - (38%) | Gaps: | 72/260 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 406 SFGSAAFRCG--------------GSLIASRFVLTAAHCVN-SDDSTPS----------FVR--- 442
Fly 443 --LGALNIENPEPG----------YQDINVIDVQIHPDYSGS-----SKYYDIAILQLAEDAKES 490
Fly 491 DVIRPACLYTDRSDP---PANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552
Fly 553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLY 617
Fly 618 617 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hayan | NP_001097020.1 | CLIP | 32..80 | CDD:197829 | |
Tryp_SPc | 384..627 | CDD:214473 | 63/260 (24%) | ||
Tryp_SPc | 385..630 | CDD:238113 | 63/260 (24%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 53/226 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |