DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and try-9

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:260 Identity:63/260 - (24%)
Similarity:99/260 - (38%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 SFGSAAFRCG--------------GSLIASRFVLTAAHCVN-SDDSTPS----------FVR--- 442
            |.||.:||.|              |:|::...::||||.:. |:|..|.          |||   
 Worm     6 SDGSGSFRNGGNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYK 70

  Fly   443 --LGALNIENPEPG----------YQDINVIDVQIHPDYSGS-----SKYYDIAILQLAEDAKES 490
              :..:|:....|.          ::.:.:..:.|...|.|.     ..:.|||:.:|.|..:.|
 Worm    71 NFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFS 135

  Fly   491 DVIRPACLYTDRSDP---PANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552
            ..|.||||.:....|   ...||.|  |:| .:.::..:....|::....|.  ||:..|.    
 Worm   136 KDIFPACLPSAPKIPRIRETGYKLF--GYG-RDPSDSVLESGKLKSLYSFVA--ECSDDFP---- 191

  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLY 617
                     .....|.:..| |..:|.||||.. ::...|......:|||:|:|..|    |.||
 Worm   192 ---------YGGVYCTSAVN-RGLSCDGDSGSG-VVRTSDTRNVQVLVGVLSAGMPC----PELY 241

  Fly   618  617
             Worm   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 63/260 (24%)
Tryp_SPc 385..630 CDD:238113 63/260 (24%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 53/226 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.