DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG17572

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:137/293 - (46%) Gaps:39/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SRVNLPEKERPSVAACEKIRSGGKPLTV-HILDGERVDRGVYPHMAAIAYN--SFGSAAFRCGGS 417
            |...||....|| :..||.:..||.|.. |...|    .|.||.:|.|.:.  :.|:.|:.|.|:
  Fly   104 SSEELPYVCCPS-SPLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGA 163

  Fly   418 LIASRFVLTAAHC--VNSDDSTPSFVRLGALNI-ENPE---PGY---QDIN--VIDVQIHPDYSG 471
            :||.|.:||||||  ..:|....|.||:|..:. .:|:   .|:   :.:|  :..|.:||||..
  Fly   164 VIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQ 228

  Fly   472 SSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALD 536
            ...::|||:|.|......|...:|.||...|::.....:..:||||.|: |:......:....:.
  Fly   229 GQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMS-TSSVRQPEMSHLDVP 292

  Fly   537 LVPADECNASFA-----EQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGT 596
            |...|.|..::.     |.|::       :....:||.  .:.||.|||..|.||.::   .:|.
  Fly   293 LTSWDLCLRNYGSTGALESPNS-------IEGQWMCAG--GEGKDVCQGFGGAPLFIQ---ENGI 345

  Fly   597 YSIVGVISSGF-GC-ATKTPGLYTRVSSFLDYI 627
            :|.:|::|.|. .| ..:.|.:||.|:.|.::|
  Fly   346 FSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 75/262 (29%)
Tryp_SPc 385..630 CDD:238113 75/263 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 74/254 (29%)
Tryp_SPc 138..378 CDD:214473 73/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.