DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG4650

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:107/257 - (41%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 IAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDIN------- 459
            :||.......:.|||::|..:.|||||||..:.:..  ..|:|..      .|..|.|       
  Fly    45 MAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQL--VARIGEF------IGTDDANDTMLSEY 101

  Fly   460 -VIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL--------YTDRSDPPANYKYFVAG 515
             |....||..|:.::...|||||.||.|...|..|||.|:        |.|.....:.     |.
  Fly   102 QVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSG-----AQ 161

  Fly   516 WGVMNVTNRA----VSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKD 576
            ||:.|..|.:    ::.|..:      ||:.|:       :.|.|   .:::||.||.|.:.:  
  Fly   162 WGLPNDRNESDAFRITDIRRQ------PANMCS-------TLNGT---AILSSQFCAGDSDSK-- 208

  Fly   577 ACQGDSGGPL--ILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIEGIVWPSNR 636
            .|..|...||  |:...::. .|.::|:.::...|  |...:||.|.|..|:|.. ||...|
  Fly   209 LCNVDFSSPLGAIITFKNIQ-RYVLIGIATTNQKC--KRASVYTDVLSHTDFILS-VWRQYR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 67/246 (27%)
Tryp_SPc 385..630 CDD:238113 68/249 (27%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/246 (27%)
Tryp_SPc 33..258 CDD:304450 67/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.