DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:102/261 - (39%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIE 449
            |.:|.....|..|:...:.:    |..:.||||:||..:||||.||:.  |:....|..||....
  Fly    37 ITNGYAAPEGKAPYTVGLGF----SGGWWCGGSIIAHDWVLTAEHCIG--DAASVIVYFGATWRT 95

  Fly   450 NPE------------PGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDR 502
            |.:            ....||.:|.:. |.|:     ::.:..::|..             |.||
  Fly    96 NAQFTHTVGNGNFIKHSNADIALIRIP-HVDF-----WHMVNKVELPS-------------YNDR 141

  Fly   503 SDPPANYKYFVA---GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIAS 564
            .:   ||..:.|   ||| .......:...|....|.:|..:||..::            |.:..
  Fly   142 YN---NYNEWWAVACGWG-GTYDGSPLPDWLQCVDLQIVHNEECGWTY------------GSVGD 190

  Fly   565 QLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGV---ISSGFGCATKTPGLYTRVSSFLDY 626
            .:........|..|.|||||||:..    ||: .:|||   :||. ||.:..|..:.||:..||:
  Fly   191 NVICTRTVDGKSICGGDSGGPLVTH----DGS-KLVGVSNFVSSN-GCQSGAPAGFQRVTYHLDW 249

  Fly   627 I 627
            |
  Fly   250 I 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 66/259 (25%)
Tryp_SPc 385..630 CDD:238113 67/261 (26%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 66/259 (25%)
Tryp_SPc 37..253 CDD:238113 67/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436982
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.