DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss34

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:277 Identity:85/277 - (30%)
Similarity:130/277 - (46%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 PLT---------VHILDGERVDRGVYPHMAAIAYNSFGSAAF--RCGGSLIASRFVLTAAHCVNS 433
            |||         |.|:.|..|....:|...::.......:.:  .||||||..::||||||||..
Mouse    21 PLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRP 85

  Fly   434 DDSTPSFVR--LGALNI-ENPEPGYQDINVIDVQIHPDYS------GSSKYYDIAILQLAEDAKE 489
            .:.....||  :|.|.: ||.    |.:.|:.:..||.:|      |.:   |||:|:|......
Mouse    86 KEVEAYGVRVQVGQLRLYEND----QLMKVVKIIRHPKFSEKLSARGGA---DIALLKLDTRVVL 143

  Fly   490 SDVIRPACLYTDRSDPPANYKY------FVAGWGVM-NVTNRAVSKILLRAALDLVPADECNASF 547
            |:.:.|..|      |.|:.:.      :||||||: |.........|...|:.:|..::|...:
Mouse   144 SEHVYPVSL------PAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKY 202

  Fly   548 AEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATK 612
            ....|::.|.|  :|...:..|.|..| |:|:.||||||:..   .:.::..|||:|.|.||...
Mouse   203 QTNSSSDSTTR--IIKDDMLCAGKEGR-DSCKADSGGPLVCR---WNCSWVQVGVVSWGIGCGLP 261

  Fly   613 T-PGLYTRVSSFLDYIE 628
            . ||:||||.|::.:|:
Mouse   262 DFPGVYTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 80/261 (31%)
Tryp_SPc 385..630 CDD:238113 81/263 (31%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 80/261 (31%)
Tryp_SPc 35..277 CDD:214473 80/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.