DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and sphe

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:113/250 - (45%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSD----DSTPSFVRLGA 445
            |:.||..|.......|::..::    |..||||:::...:||.||||:.|    |::....|:|:
  Fly    26 IMGGEDADATATTFTASLRVDN----AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS 86

  Fly   446 LNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPA-NY 509
               .|...|.:.:||..|.:||||...:.  ::|::.|:.:...:|.|....|.......|| ..
  Fly    87 ---TNQYAGGKIVNVESVAVHPDYYNLNN--NLAVITLSSELTYTDRITAIPLVASGEALPAEGS 146

  Fly   510 KYFVAGWG-VMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQ 573
            :..||||| ..:.||   |..:.:.:|.:.|...|..::::...           ...|.|.: .
  Fly   147 EVIVAGWGRTSDGTN---SYKIRQISLKVAPEATCLDAYSDHDE-----------QSFCLAHE-L 196

  Fly   574 RKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIE 628
            ::..|.||.||..|.....:..|..:||      .|.::.|.::.|:||:.|:|:
  Fly   197 KEGTCHGDGGGGAIYGNTLIGLTNFVVG------ACGSRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 64/247 (26%)
Tryp_SPc 385..630 CDD:238113 65/249 (26%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/233 (26%)
Tryp_SPc 42..244 CDD:214473 59/231 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.