DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG31269

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:111/250 - (44%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ILDGERVDRGVYPHMAAIAYNSFG-SAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNI 448
            |:.|:..:.|..|:..::.    | |.|..|||::|...||||||||| .:...|..|.:...|.
  Fly    38 IIGGQAAEDGFAPYQISLQ----GISGAHSCGGAIINETFVLTAAHCV-ENAFIPWLVVVTGTNK 97

  Fly   449 ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFV 513
            .|...|...:..|  .||.:|.....:.|||:|:|.|.....:..:|..|......|  ..:..:
  Fly    98 YNQPGGRYFLKAI--HIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP--GDEVIL 158

  Fly   514 AGWG--VMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKD 576
            .|||  |:..|:....::|.   |..||..||.|..:.....:        ...:|...: ..:.
  Fly   159 TGWGSTVLWGTSPIDLQVLY---LQYVPHRECKALLSNDEDCD--------VGHICTFSR-LGEG 211

  Fly   577 ACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYIEGIV 631
            ||.|||||||      |...| :||:::.|:.|||..|.::..|..:.|:|..::
  Fly   212 ACHGDSGGPL------VSNGY-LVGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 71/244 (29%)
Tryp_SPc 385..630 CDD:238113 72/247 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/244 (29%)
Tryp_SPc 38..258 CDD:238113 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.