DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG31205

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:99/233 - (42%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 GSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF-VRLGALNIENPEPGYQDINVID-VQIHPDYS 470
            ||....|.|.||.||.|:||||||:.|:|...: |..|..:..|       ||::. |.:|||||
  Fly    62 GSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSN-------INLVSAVTVHPDYS 119

  Fly   471 GSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPP----ANYKYFVAGWGVMNVTNR--AVSKI 529
            ......|:||::|.::...||:::|.||.:.....|    :|.|..|||....:...|  |..::
  Fly   120 PRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRL 184

  Fly   530 LLRAALDLVPAD--ECN---ASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILE 589
            ..|..:.....|  ||:   |.|.|:.....|.|..:..|.|..|....|:              
  Fly   185 DKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTPRQ-------------- 235

  Fly   590 IDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYI 627
                   :.::|:..:||..:......|..:...||:|
  Fly   236 -------FHLLGIAVAGFFSSDLDHQGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 64/231 (28%)
Tryp_SPc 385..630 CDD:238113 65/233 (28%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 41/112 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.