DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and sphinx1

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:263 Identity:47/263 - (17%)
Similarity:107/263 - (40%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 LTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCG-GSLIASRFVLTAAHCVNSDDSTPSFVRLG 444
            |:..|..|.|.......::..|.|....:::...| |::|:::::||....:..     |::.:.
  Fly    22 LSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKY-----SYIEVH 81

  Fly   445 ALNIENPEPGYQDINVIDVQIHPDYSGSSKY-YD----IAILQLAEDA--KESDVIR-PACLYTD 501
            ..:    ...|:..::|.:     |..:.:: ||    ||:::.....  :..|.:| ||  |..
  Fly    82 LAS----RRSYRGFDIIRI-----YKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPA--YDT 135

  Fly   502 RSDPPANYKYFVAGWGVMNVTNRAVSKI---LLRAALDLVPADECNASFAEQPSANRTLRRGVIA 563
            |.:........|.|:|    |.:..:|:   :....::::...||...:..           :..
  Fly   136 RFERYVGNMTMVCGYG----TEKRHAKLPEWMRCIEVEVMNNTECAKYYTP-----------LKW 185

  Fly   564 SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVI-SSGFGCATKTPGLYTRVSSFLDYI 627
            .::|.:.:. .|..|:||.||.::    .:....:.:|:| .....|:...|.::.|||..:.:|
  Fly   186 YEMCTSGEG-FKGVCEGDIGGAVV----TMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWI 245

  Fly   628 EGI 630
            :.:
  Fly   246 KRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 45/255 (18%)
Tryp_SPc 385..630 CDD:238113 46/257 (18%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 45/255 (18%)
Tryp_SPc 26..248 CDD:304450 46/257 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.