DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and spirit

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:384 Identity:126/384 - (32%)
Similarity:179/384 - (46%) Gaps:83/384 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 TPAPTPTQL------IDPFEPYRFRGQDRDKDTQPQEPWNDVSNNLDADPAPSIFNPAETRPTTP 351
            |||.:|..|      ::.|:..:.....|.|.|..:           .:..||..|....|..:|
  Fly    30 TPAISPQSLRGIIFPVETFDECQLEDVARTKGTCRR-----------MEDCPSALNGWLERRESP 83

  Fly   352 NP------------NPSRVNLPEKERPSVAACEKIRSGGK-----PLTVHILDGERVDRGVYPHM 399
            ..            .|:..  |...|.|..||.::....|     ...|.::.|.......:|.|
  Fly    84 KTCYFVRFDHYVCCAPAVA--PIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFM 146

  Fly   400 AAIAYNS-FGSAA-FRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDINVID 462
            ||:.:.| |.... :||||:|||:.||||||||.:.....||.||||..|:...|.  :||::..
  Fly   147 AALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG--EDISIRR 209

  Fly   463 VQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVS 527
            |.||||||.|:.|.|||:|:|...||..  ::|.|::|.:                 .|||..|:
  Fly   210 VIIHPDYSASTAYNDIALLELETAAKPE--LKPTCIWTQK-----------------EVTNTLVT 255

  Fly   528 KI--------------LLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDAC 578
            .|              ||:..|..|..:||...:.:.     .|.:||:.:|:||.|....:|.|
  Fly   256 AIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKD-----QLAQGVLGTQMCAGDITGERDTC 315

  Fly   579 QGDSGGPLILEIDDVDGTYS-IVGVISSGFGCATKTPGLYTRVSSFLDYIEGIVWPSNR 636
            ||||||||:::    ||... :||:.|.|.|||:..|.:|||||||:|:|||||||:.:
  Fly   316 QGDSGGPLLMQ----DGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 97/259 (37%)
Tryp_SPc 385..630 CDD:238113 99/261 (38%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 8/57 (14%)
Tryp_SPc 132..364 CDD:238113 99/261 (38%)
Tryp_SPc 132..361 CDD:214473 97/258 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.