DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG11664

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:264 Identity:62/264 - (23%)
Similarity:104/264 - (39%) Gaps:70/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 LTVHILDGERVDRGVYPHMAAIAYNSFG------SAAFRCGGSLIASRFVLTAAHCVNSDDSTPS 439
            |.:.:..|:.:.||:     .:...::|      ...|...|||.::|:|||.|||... ::.|.
  Fly    13 LAIAVRWGDALHRGI-----PVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKK-NTKPE 71

  Fly   440 FVRLGALNIENPEPGYQDI-------NVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIR--- 494
            .:.:.|        ||:.|       .|..:..||.:|..:...|||:|::......|.:|.   
  Fly    72 ELSVRA--------GYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIG 128

  Fly   495 -------PACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552
                   |..::.    ||..    :|||.:|:     :::.|...::.:.|...|...|.:   
  Fly   129 LCSRPLTPLNMFA----PPQE----LAGWNLMH-----IAQPLKSMSVQVEPEKNCRQWFPQ--- 177

  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKT-PGL 616
                :..|||    ||: ....:..|.||||.|||       ....:.|:..:...|..|. |.|
  Fly   178 ----ISGGVI----CAS-ATMGEGLCYGDSGDPLI-------SGGEVCGLAIAFRKCGDKRYPAL 226

  Fly   617 YTRV 620
            :|.|
  Fly   227 FTDV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 61/261 (23%)
Tryp_SPc 385..630 CDD:238113 61/260 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 57/234 (24%)
Tryp_SPc 38..237 CDD:214473 57/234 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.