DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss30

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:275 Identity:91/275 - (33%)
Similarity:138/275 - (50%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHC 430
            |||  |...|..||     |:.|:....|.:|...::.....|..   ||||||...:|||||||
Mouse    62 PSV--CGHSRDAGK-----IVGGQDALEGQWPWQVSLWITEDGHI---CGGSLIHEVWVLTAAHC 116

  Fly   431 VNSDDSTPSF--VRLGALNIENPEPGYQDINVIDVQIHPDY------SGSSKYYDIAILQLAEDA 487
            ... ...|||  |::|.|.:...||....:.|.::.:||.|      ||     |||::||....
Mouse   117 FRR-SLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSG-----DIALVQLDTPL 175

  Fly   488 KESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552
            :.|. ..|.||...::........:|.|||.  ...|.::.:|...|:.|:.:::|...:..|.|
Mouse   176 RPSQ-FTPVCLPAAQTPLTPGTVCWVTGWGA--TQERDMASVLQELAVPLLDSEDCEKMYHTQGS 237

  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATK-TPGL 616
             :.:..|.:.:..|||.....:||:|||||||||:..|   :.:::.||:.|.|.|||.. .||:
Mouse   238 -SLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSI---NSSWTQVGITSWGIGCARPYRPGV 298

  Fly   617 YTRVSSFLDYIEGIV 631
            ||||.:::|:|:.|:
Mouse   299 YTRVPTYVDWIQRIL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/251 (33%)
Tryp_SPc 385..630 CDD:238113 83/253 (33%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 83/253 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.