DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Tpsg1

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:289 Identity:88/289 - (30%)
Similarity:130/289 - (44%) Gaps:51/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 SVAACEKIRSGGKPLTVH----ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTA 427
            :|..|      |:|...|    |:.|.....|.:|..|::....    ...|||||::..:||||
  Rat    14 AVPGC------GQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQK----VHVCGGSLLSPEWVLTA 68

  Fly   428 AHC----VNSDDSTPSFVRLGALNIENPEPGYQDI-NVIDVQIHPDYSGSSKYYDIAILQLAEDA 487
            |||    |||.|..   |.||.|.| ...|.:..: .:|.....|...|||.  |||::|||...
  Rat    69 AHCFSGSVNSSDYE---VHLGELTI-TLSPHFSTVKQIIMYSSAPGPPGSSG--DIALVQLATPV 127

  Fly   488 KESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKI-LLRAALDLVPADECNASFAEQP 551
            ..|..::|.||....:|.....:.:|.|||............ |..|.:.:|..:.|:.:::   
  Rat   128 ALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYS--- 189

  Fly   552 SANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA-TKTPG 615
            |:|.:|   :.:..|||....   ||||.||||||:..   |.|.:...||:|.|.||. ...||
  Rat   190 SSNGSL---IQSDMLCAWGPG---DACQDDSGGPLVCR---VAGIWQQAGVVSWGEGCGRPDRPG 245

  Fly   616 LYTRVSSFLDYI------------EGIVW 632
            :|.||::::::|            :|:.|
  Rat   246 VYARVTAYVNWIHRHILEPGGSGMQGLSW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/253 (32%)
Tryp_SPc 385..630 CDD:238113 81/263 (31%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 80/249 (32%)
Tryp_SPc 30..260 CDD:238113 81/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.