DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss34

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:279 Identity:89/279 - (31%)
Similarity:134/279 - (48%) Gaps:47/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 PLT-------VHILDGERVDRGVYPHMAAIAYNSFGSAAFR--CGGSLIASRFVLTAAHCVNSDD 435
            |||       |.|:.|..|....:|...::.:.:...:.:.  ||||||..::||||||||...:
  Rat    21 PLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKE 85

  Fly   436 STPSF--VRLGALNI-ENPEPGYQDINVIDVQIHPDYS------GSSKYYDIAILQLAEDAKESD 491
            ...|.  |::|.|.: ||.    |.:.|..:..||.:|      |.:   |||:|:|......|:
  Rat    86 MEASCFRVQVGQLRLYEND----QLMKVAKIIRHPKFSEKLSAPGGA---DIALLKLDSTVVLSE 143

  Fly   492 VIRPACLYTDRSDPPANYK------YFVAGWGVMNVTNRAVSKILLR-AALDLVPADECNASFAE 549
            .:.|..|      |.|:.:      ::||||||:...........|| .|:.:|...:|...:..
  Rat   144 RVHPVSL------PAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRT 202

  Fly   550 QPSANRTLRRGVIA-SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKT 613
            ..|.:||.:  :|. ..|||.  .:.:|:||.||||||:..   .:.::..|||:|.|.||....
  Rat   203 YSSLDRTTK--IIKDDMLCAG--MEGRDSCQADSGGPLVCR---WNCSWVQVGVVSWGIGCGLPD 260

  Fly   614 -PGLYTRVSSFLDYIEGIV 631
             ||:||||.|:|.:|.|.|
  Rat   261 FPGVYTRVMSYLSWIHGYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/262 (31%)
Tryp_SPc 385..630 CDD:238113 83/264 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 82/262 (31%)
Tryp_SPc 33..275 CDD:214473 82/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.