DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss30

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:274 Identity:85/274 - (31%)
Similarity:137/274 - (50%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 KIRSGGKPLTVH-----ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHC-- 430
            :|.:||:...:|     |:.|:....|.:|...::.....|..   ||||||...:|||||||  
  Rat    14 QILTGGRGDILHSGAGKIVGGQDAPEGRWPWQVSLRTEKEGHI---CGGSLIHEVWVLTAAHCFC 75

  Fly   431 --VNSDDSTPSF--VRLGALNIENPEPGYQDINVIDVQIHPDY------SGSSKYYDIAILQLAE 485
              :||     ||  |::|.|.:...||....:.|.::.::|.|      ||     |||:|:|..
  Rat    76 RPLNS-----SFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSG-----DIALLRLDT 130

  Fly   486 DAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQ 550
            ..:.|. ..|.||...::........:|.|||..:  .|.::.:|...|:.|:.:::|...: ..
  Rat   131 PLQPSQ-FSPVCLPQAQAPLTPGTVCWVTGWGATH--ERELASVLQELAVPLLDSEDCERMY-HI 191

  Fly   551 PSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA-TKTP 614
            ...:.:.:|.:.:..|||.....:||:|||||||||:..|   :.::..||:.|.|.||| ...|
  Rat   192 GETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAI---NSSWIQVGITSWGIGCARPNKP 253

  Fly   615 GLYTRVSSFLDYIE 628
            |:||||..::|:|:
  Rat   254 GVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/260 (31%)
Tryp_SPc 385..630 CDD:238113 81/257 (32%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.