DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG33462

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:114/272 - (41%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 DRGVYPH-------MAAIAYNSFGS-----AAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLG 444
            |.|: ||       .|.:|.|.:.:     ..|.|.|:||...|||||||||  .|.....||||
  Fly    28 DCGI-PHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV--PDDLLITVRLG 89

  Fly   445 ALNIEN---------PEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYT 500
            ..|.:.         .|| :|:.||.....|..|:.:.:..||.:|:|....:..:.|||.|::.
  Fly    90 EYNTKTKVDCDNHLCQEP-FQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153

  Fly   501 DR--SDPPANYKYFVAG-WGVMNVTNRAVSKILLRAALDLVPADEC------NASFAEQPSANRT 556
            ..  .:|.....:|... |  ......|.||:|....:|..|.:.|      |.:| ||..|..|
  Fly   154 SNRFQEPIDQLTWFTTTVW--RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF-EQICAGNT 215

  Fly   557 LRRGVIASQLCAADKNQRKDACQGDSGGPLILEI-DDVDGTYSIVGVISSGFG-CATKTPGLYTR 619
            |      ||||:.           |||.|.|.:: .:....|..:|:.|...| |  :..|:...
  Fly   216 L------SQLCST-----------DSGAPQIRKMWHNGSDRYVQLGIASRVKGQC--QNSGILMD 261

  Fly   620 VSSFLDYIEGIV 631
            :.|:.|:|:.:|
  Fly   262 LLSYADWIKRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 76/266 (29%)
Tryp_SPc 385..630 CDD:238113 77/269 (29%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/248 (28%)
Tryp_SPc 48..269 CDD:214473 69/245 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.