DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG30090

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:113/252 - (44%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDINV- 460
            |.||.|    ..|....|||:||..|||||||||||...:..  ||||    |..:...:|.|. 
  Fly    52 PWMAYI----HSSVKLICGGTLITQRFVLTAAHCVNEGSAVK--VRLG----EYDDTATEDCNSK 106

  Fly   461 ----------IDVQI-HPDYSGSSKYYDIAILQLAEDAKESDVIRPAC--LYTDRSDPPANYKYF 512
                      :|:.. |..:|......|||:|:||:.......|.|.|  |.|.:.:...:.::|
  Fly   107 ICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF 171

  Fly   513 VA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKD 576
            || |||... |:|.      |..|.:......|:|...|     .|.|.|..:|:||.  ....|
  Fly   172 VATGWGETR-THRT------RGVLQITQLQRYNSSQCMQ-----ALGRLVQQNQICAG--RLGSD 222

  Fly   577 ACQGDSGGPLILEIDDVDGTYSI-VGVISSGF-GCATKTPGLYTRVSSFLDYIEGIV 631
            .|.|||||||...:..:|....: .||:|.|. .|:  ..|:||.|.|:.|:|..:|
  Fly   223 TCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECS--GIGVYTDVYSYADWIATVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/246 (33%)
Tryp_SPc 385..630 CDD:238113 83/249 (33%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 82/246 (33%)
Tryp_SPc 40..276 CDD:238113 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.