DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG30088

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:126/257 - (49%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF-VRLGALNI-ENPE------- 452
            |.||.:.|    |:...|||::|:||::||||||:.     |.. ||||..:| .||:       
  Fly    57 PFMAYLYY----SSEIHCGGTIISSRYILTAAHCMR-----PYLKVRLGEHDITRNPDCQGGSCS 112

  Fly   453 PGYQDINVIDVQIHPDYSGSSKYY--DIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAG 515
            |..::   .|:.:...|....::.  |||:|:|:.:.:.:..|:|.||..:.:..|..:::...|
  Fly   113 PPAEE---FDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFG 174

  Fly   516 WGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQG 580
            || ...||.: :.:|....|.......|.:          .|...:..:|||..  .|..|.|.|
  Fly   175 WG-QTETNHS-ANVLQTTVLTRYDNRHCRS----------VLSMPITINQLCVG--FQGSDTCSG 225

  Fly   581 DSGGPLILEIDDVDGT--YSIVGVISSGFG---CATKTPGLYTRVSSFLDYIEGIVWPSNRF 637
            ||||||:.:: :.||.  |..:|::|  ||   |  ::||:||.|.:::.:|. .|..||.:
  Fly   226 DSGGPLVTKV-NYDGVWRYLQLGIVS--FGDDKC--QSPGVYTYVPNYIRWIR-YVMQSNGY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 73/245 (30%)
Tryp_SPc 385..630 CDD:238113 74/248 (30%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 73/245 (30%)
Tryp_SPc 45..273 CDD:238113 73/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.