DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG30087

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:124/258 - (48%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 VHILDG-ERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF-VRLGA 445
            :.:::| |.|.|.. |.|..:..||.    ..||||::.||::|||||||     .|:. :|||.
  Fly    40 MRVVNGKEAVIRSA-PFMVYVTNNSL----THCGGSILNSRYILTAAHCV-----FPNLRLRLGE 94

  Fly   446 LNI--------ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDR 502
            .||        .|..|..::..::....|..|:.::...|||:|:|......:..|:|.|:..:.
  Fly    95 HNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNP 159

  Fly   503 SDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567
            :..|:...|...|||  .........:|..|.|....|..|:.||....:.|          |:|
  Fly   160 ASAPSVATYQTFGWG--ETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGN----------QIC 212

  Fly   568 AADKNQRKDACQGDSGGPLILEIDDVDGT--YSIVGVISSG-FGCATKTPGLYTRVSSFLDYI 627
            |.  ::.:|.|.|||||||:..: |.||.  |..:|::|.| ..|  ::||:||.|.:::::|
  Fly   213 AG--HEERDTCAGDSGGPLVTRV-DFDGVKRYLQLGIVSYGPTDC--QSPGVYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 77/255 (30%)
Tryp_SPc 385..630 CDD:238113 78/256 (30%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/255 (30%)
Tryp_SPc 42..272 CDD:238113 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.