DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG30083

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:283 Identity:96/283 - (33%)
Similarity:131/283 - (46%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAI-AYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF 440
            |...::..|:.|:..:.|..|.||.| .||....|...|||:||..:|||:||||:..|....  
  Fly    26 GYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILA-- 88

  Fly   441 VRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYY-------DIAILQLAEDAKESDVIRPACL 498
            ||||    |:....|..:.         .:..:||:       ||.||::....|.:.||||.|:
  Fly    89 VRLG----EHSSSRYFAVT---------KAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICI 140

  Fly   499 YTDRSDPPANYKYF-VAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVI 562
            .||.:..| |.|.| .||||  ...|...||:|....|:.:.|.||          ...|...|.
  Fly   141 ITDPTKVP-NVKTFKAAGWG--KTENETFSKVLKTVELNELNASEC----------YNMLWVNVT 192

  Fly   563 ASQLCAADKNQRKDACQGDSGGPLILEIDDVDGT--YSIVGVISSGFGCATKTPGLYTRVSSFLD 625
            .||:||...:  .|.|.||||||||..: .:||:  |..:|:||.| .....:||:|||:|||:|
  Fly   193 ESQICAGHPD--GDTCAGDSGGPLIHPV-YMDGSLRYVQLGIISFG-SSLCNSPGVYTRLSSFID 253

  Fly   626 YIEGI---------------VWP 633
            :|..:               |||
  Fly   254 WILMVVDNYTVRSPPKIQYRVWP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 91/253 (36%)
Tryp_SPc 385..630 CDD:238113 92/255 (36%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 91/253 (36%)
Tryp_SPc 34..255 CDD:238113 91/252 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.