DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Prss8

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:280 Identity:82/280 - (29%)
Similarity:126/280 - (45%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SRVNLPEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIA 420
            ||:.....|    |:|      |..:...|..|.....|.:|...:|.||    ....|||||::
  Rat    26 SRIGADGTE----ASC------GAVIQPRITGGGSAKPGQWPWQVSITYN----GVHVCGGSLVS 76

  Fly   421 SRFVLTAAHCVNSDDSTPSF-VRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLA 484
            :::|::||||...:.|...: |:|||..:::.........|..:..|..|.......|||:::|:
  Rat    77 NQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLS 141

  Fly   485 EDAKESDVIRPACLYTDRSDPPANYKYFVAGWG-VMNVTNRAVSKILLRAALDLVPADECNASF- 547
            .....|..|||.||....:..|......|.||| |....:....:.|.:..:.|:..:.|:..: 
  Rat   142 SPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYN 206

  Fly   548 ----AEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFG 608
                .|:|   .|:::    ..|||......||||||||||||...|   ||.:.:.|::|.|..
  Rat   207 INAVPEEP---HTIQQ----DMLCAGYVKGGKDACQGDSGGPLSCPI---DGLWYLAGIVSWGDA 261

  Fly   609 C-ATKTPGLYTRVSSFLDYI 627
            | |...||:||..|::..:|
  Rat   262 CGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 75/250 (30%)
Tryp_SPc 385..630 CDD:238113 76/251 (30%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 75/250 (30%)
Tryp_SPc 45..284 CDD:238113 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.