DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and Tpsb2

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:122/285 - (42%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IRSGGKPLT--VHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDS 436
            :.|..:|..  |.|:.|.......:|...::.:.......| ||||||..::||||||||.....
Mouse    19 VYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHF-CGGSLIHPQWVLTAAHCVGPHIK 82

  Fly   437 TPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD 501
            :|...|: .|..:....|.|.:::..:.:||.|..:....|:|:|:|......|..:.|..|   
Mouse    83 SPQLFRV-QLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISL--- 143

  Fly   502 RSDPPANYKY------FVAGWGVMNVTNRAVSKILLRAALDL---------VPADECNASFAEQP 551
               |||:..:      :|.|||                  |:         .|..:......|..
Mouse   144 ---PPASETFPPGTSCWVTGWG------------------DIDNDEPLPPPYPLKQVKVPIVENS 187

  Fly   552 SANRTLRRGVIA---------SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF 607
            ..:|....|:..         ..|||.  |.|:|:|||||||||:.:   |.||:...||:|.|.
Mouse   188 LCDRKYHTGLYTGDDFPIVHDGMLCAG--NTRRDSCQGDSGGPLVCK---VKGTWLQAGVVSWGE 247

  Fly   608 GCA-TKTPGLYTRVSSFLDYIEGIV 631
            ||| ...||:||||:.:||:|...|
Mouse   248 GCAQPNKPGIYTRVTYYLDWIHRYV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 78/267 (29%)
Tryp_SPc 385..630 CDD:238113 79/269 (29%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.