DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG43742

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:267 Identity:78/267 - (29%)
Similarity:117/267 - (43%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 LTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGA 445
            :|..:.:|.......:  |||:..||    .|.||||||..::||||||||...|...  |.||.
  Fly    31 ITYRVANGHTAITSQF--MAALYNNS----EFFCGGSLIHKQYVLTAAHCVRDLDEVT--VHLGE 87

  Fly   446 LNIENPEPGYQDINVIDVQI--HPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPAN 508
            .|...|.|..:.:..::.::  ||::.|:....|||:|:|..:......|||.|:..|......|
  Fly    88 NNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNN 152

  Fly   509 YKYFVA-GWGVMNVTNRAVSKILLRAALDLV--PADECNASFAEQPSANRTLRRGVIASQLCAAD 570
            ...|.| |||.....|  :|.:|  :.:|||  |...|..:.                :.:||..
  Fly   153 QNNFTAYGWGKTEHGN--ISDVL--SFIDLVRLPKSMCYQNI----------------NTICAGS 197

  Fly   571 KNQRKDACQGDSGGPLILEIDDVDGTY--------SIVGVISSGFGCATKTPGLYTRVSSFLDYI 627
            .:  .|.|:.|||||||       |.:        .:.|:.|.|....:...|:||.|:::..:|
  Fly   198 TS--GDTCESDSGGPLI-------GNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWI 253

  Fly   628 EGIVWPS 634
            ..:|..|
  Fly   254 ASVVLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 74/255 (29%)
Tryp_SPc 385..630 CDD:238113 75/257 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 74/255 (29%)
Tryp_SPc 35..256 CDD:238113 75/257 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.