DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG43336

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:267 Identity:79/267 - (29%)
Similarity:107/267 - (40%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 RVDRGVYPHMAAIAYNSF---GSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENP 451
            ||..|....:.:..:.:|   ....|.||||||.:|.|||||||..  |.|....|||..:.|..
  Fly    37 RVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCFL--DRTELVARLGEYDREEY 99

  Fly   452 EPGYQDINVIDVQI-------HPDYSGSSKYYDIAILQLAEDAKESDVIRPACL--------YTD 501
            |..:.......::.       |..|:..:..||||||:|....:.:|.|||.|:        |.|
  Fly   100 EMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYID 164

  Fly   502 RSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANR---TLRRGVIA 563
            ..||...     .|||   .|........|| .:||.         .:.|...|   ||  .:.|
  Fly   165 SLDPLTG-----TGWG---KTESEGDSAKLR-TVDLA---------RKHPEVCRRYATL--SLTA 209

  Fly   564 SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVG----VISSGFGCATKTP----GLYTRV 620
            :|.||.  |:|.:.|.||||||:        |.....|    .:..|....|.|.    .::|.|
  Fly   210 NQFCAG--NERSNLCNGDSGGPV--------GALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDV 264

  Fly   621 SSFLDYI 627
            .|::|:|
  Fly   265 MSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 78/265 (29%)
Tryp_SPc 385..630 CDD:238113 79/267 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 78/265 (29%)
Tryp_SPc 40..271 CDD:238113 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.