DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hayan and CG43110

DIOPT Version :9

Sequence 1:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:281 Identity:89/281 - (31%)
Similarity:121/281 - (43%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 SVAACEKIRS------GGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVL 425
            |:.:|:...|      .||.....|:.|....:....:||.|    |.:....|||::|...|||
  Fly    12 SLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGI----FNTTHLLCGGTIIHEDFVL 72

  Fly   426 TAAHCVNSDDSTPS-FVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKE 489
            |.|||    .||.: ||||||.||.:|.   ..|.||:...||.||.|:...|||:::|......
  Fly    73 TVAHC----KSTQTLFVRLGAYNINHPT---DQIRVIETIAHPQYSNSTYANDIALVKLERSVIF 130

  Fly   490 SDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSAN 554
            :..|:|.|::.|.:.......|...|||  ...|...|.||.|..::......|:......|.  
  Fly   131 NLNIQPICIHLDATLGKQIRYYNAFGWG--RTRNAEQSDILQRIFVNRTNPMICHLYLGMSPD-- 191

  Fly   555 RTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTY------SIVGVISSGFGCATKT 613
                    ..|:||.  ..:.|.|.||||||||.:|     ||      :..|:.|.|    |:.
  Fly   192 --------PKQICAT--TDQGDTCAGDSGGPLISKI-----TYQGKNFDTQFGITSYG----TRE 237

  Fly   614 ---PGLYTRVSSFLDYIEGIV 631
               .||||.||.:..:|..||
  Fly   238 CNGVGLYTDVSQYSGWIANIV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/252 (32%)
Tryp_SPc 385..630 CDD:238113 82/254 (32%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 81/252 (32%)
Tryp_SPc 36..257 CDD:238113 82/254 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.