DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42323 and CG8541

DIOPT Version :9

Sequence 1:NP_001138219.1 Gene:CG42323 / 32825 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648127.1 Gene:CG8541 / 38838 FlyBaseID:FBgn0035788 Length:275 Species:Drosophila melanogaster


Alignment Length:330 Identity:95/330 - (28%)
Similarity:126/330 - (38%) Gaps:126/330 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKVILSVVLVALIACVQAKPGGPAAY-SISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQV 64
            |||:.::|  |.||:||..|  |..|:: :|:.||||  :|.|||::.|:...|  :.|.|:..|
  Fly     1 MAFRYLIS--LCALVACANA--GLLASHVAIANPSVD--AVASTQQNVVRSFAG--TVSSYSKAV 57

  Fly    65 QTAHSQSHVQRSSISNDA----------GLAPVAAHG--------------------YAAAPAHA 99
            .|.:|......:.|.|:.          |.||:....                    ||||||..
  Fly    58 DTPYSSVRKSDTRIQNNVYTPAIKTTTYGAAPLYTQATPIVSKTLVHAPAPVVEKTVYAAAPAPV 122

  Fly   100 IA-----APAYSLGYAGHTAPAQIQGVAYGGHYAASAPAVQISGLGHSLGLGHSLGLGQSLGLGG 159
            :|     |||..:....::||||:        ||.:||.|..:                      
  Fly   123 LAKTVYSAPAPVVAKHVYSAPAQV--------YAPAAPVVAKT---------------------- 157

  Fly   160 YGGYGYGGYGSYSA-APVISHGYLAHAPV--AAAPVVKYAAAPSYAPGIIGHGIGLAAPAYAAPA 221
                      .||| |||    |.|.|||  |.||||......:.||.:........||.|||.|
  Fly   158 ----------VYSAPAPV----YAAPAPVYAAPAPVVAKTVYSAPAPVLAKTVYSAPAPVYAASA 208

  Fly   222 --------YAAPAYATHL-AGPVVKAAVA----APAL-------------------VHTSVSGHG 254
                    ||||...|:: .||   ||..    ||||                   .|.|..|.|
  Fly   209 PAVAKTVSYAAPLATTNVNHGP---AATTYTHNAPALGVSSYGSSQTVHYSPAESVSHMSFDGFG 270

  Fly   255 IHYGY 259
            .|:|:
  Fly   271 THWGF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42323NP_001138219.1 None
CG8541NP_648127.1 Cuticle_3 33..275 CDD:287932 78/292 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.